PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g10010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family MYB
Protein Properties Length: 1577aa    MW: 172942 Da    PI: 6.8755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g10010genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.44.5e-10786827346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e ++   +++G++ +k+Ia+++   +t  +c+++++k
        Tp5g10010 786 PWTSEEKETFLYMLAMHGKD-FKRIASYLT-QKTTADCIDYYYK 827
                      8*****************99.********9.9**********98 PP

2Myb_DNA-binding23.51.3e-0710011042447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++I+r +  +R+  qck ++ k+
        Tp5g10010 1001 WTDDERSAFIQGFSLFGKN-FASISRFVR-TRSQDQCKVFFSKV 1042
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.28E-14769830IPR009057Homeodomain-like
PROSITE profilePS5129314.218782833IPR017884SANT domain
SMARTSM007171.2E-8783831IPR001005SANT/Myb domain
PfamPF002498.0E-8785827IPR001005SANT/Myb domain
CDDcd001673.64E-7786828No hitNo description
Gene3DG3DSA:1.10.10.602.7E-6786832IPR009057Homeodomain-like
PROSITE profilePS5129312.49961047IPR017884SANT domain
SMARTSM007174.7E-69971045IPR001005SANT/Myb domain
SuperFamilySSF466895.54E-910001047IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-410001042IPR009057Homeodomain-like
PfamPF002498.4E-610011041IPR001005SANT/Myb domain
CDDcd001672.68E-510011042No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1577 aa     Download sequence    Send to blast
MPQDHESWDR KELLRRRKHE RPEPSFDSAF RWRASPTTPS SHHVPREFSR YGSGDFRRPS  60
CHGFERPCDI RNGRRSVDER PPHSSDTHTT VVNSWDPANS AHQPDIELCT PVRTLKFKNE  120
QKITDQRLSL PSDPHSDCGN FFEQPSSENN YCNKAYSPAK QCNDLMHGRR LANGNSVDPP  180
ILNADLEGTS DQLHLKHPQD NWFHGTSDVD GVRICGKESS LGAIGKPPAW TCSGSFASQS  240
SSFSHSSSLK SLGAVDSSDR KNEILPNIVA VTQSSSGDAT ACARTTHLAE EMSSRKKQRL  300
GWGEGLAKYE KKKVDVNTNE DATTSLENGT EEVHCLNKVI ADKSPTAAVV PEYGSPTTPS  360
SVACSSSPGF RDKSSAKAAS DASNMCRSPS PVSSIPLEGF PINIEEMDET SMERFGCLLN  420
ELLGTDDSGT GDSSSVQFTS MNRLLVWKGD ILKAVEMTES EIDLLENKHR TLMVEGGRRC  480
RVVGSSSHLC EGVEIVAKVQ EAPKAAASSV AETLVLDPVH QAVLAKVPVD VFQEVKSLSQ  540
SFPTVESNED MLPMPSMKVA ASSKEINTSS FGNQETIELS SADDYMASNE EVLCAKLLSA  600
NKKYANESSE VFNELLPRDI SSFDDSRVPG ICQRQFDSHV NEKISERTEL LRAREKILLL  660
QFKAFQLAWK KDLRQLASVK YNPKSNRKTE LYPNAKNSGH LKLPQPVRLR FSSSAPRRVS  720
VASTTELVSY MERLLQVTRL KPIRDTLRMP AMILDEKERV RSRFISSNGL IEDPCDIEKE  780
RTMINPWTSE EKETFLYMLA MHGKDFKRIA SYLTQKTTAD CIDYYYKNHK SDCFGKIKKQ  840
RAYGKEGKHT YMLAPRKNWN REMGAASLDI LGAVSIIAAN AGKVASTRQI SSKRITLRGC  900
NSSNSLQHDG NNSEGCSYSF DFPRKRTLGA DVLAVGPLSS KQINSCLRTS VNSGEGCMDH  960
VKFDPVVKKP RISHTTRNEN SNEDDDSCSE ESCGETGTIH WTDDERSAFI QGFSLFGKNF  1020
ASISRFVRTR SQDQCKVFFS KVRKCLGLEC MQSGSGNAST SASVDNAIEP GGSDLEDPCA  1080
MESNPGICNN GVSAKMGLNS PTSPFNMNQE GANLSGSANV KASVSRSEQE NGLTYLRLKD  1140
GTNLVNNACT NGGFPGLVSE PCRDLVDINT VESHCHAAGK GESQCHATVT TKSNNLLSME  1200
IDEGNLTSVA VSSDPLYCGS SVLSNITVET PTETSRKGSG GQGAALPKQS SKIQDGVMQA  1260
ANRIRNSGLE AEPALSSFRY PECLHHVPIE VSTEDLVGVS VPQGNLSCHT ESESPNSLVE  1320
QVVQTNNLGW QFSKVNLDSD GRLRVLGHFN PEQNGQLNAT DTETCQIPWR SFTQDPSRIS  1380
RSKSDLIVKT QRTCEGFSLK KCTSSATKPL TIFHKDGRSG HSRSHSFSLS DTERLDKNGD  1440
VKLFGTVLTT EENGSKQNHN PGGSIRSSST LSRDHDTGHQ YINQQHLQNV PITSYGFWDG  1500
NRIQTGLTSL PESAKLLTSC PEAFTTHLKQ QVVSTKEIQL DVSGILSFGK RIEDRANVSS  1560
SKDEGNVGVN GVAEAAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D1e-16743834393NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C1e-16743834393NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403821.10.0hypothetical protein EUTSA_v10010054mg
TrEMBLV4LND50.0V4LND5_EUTSA; Uncharacterized protein
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein